DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and guca1g

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001011660.1 Gene:guca1g / 494572 ZFINID:ZDB-GENE-050120-1 Length:187 Species:Danio rerio


Alignment Length:163 Identity:52/163 - (31%)
Similarity:87/163 - (53%) Gaps:5/163 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLS 106
            ||:.:|..|...||.|.:|...|:.|:.........:||...:||:||.|.:..|.|.:.:..:.
Zfish    17 EIQPLYTRFMKVCPSGALHLHEFRRIFGVQSSSEEEALYMETIFKSFDTNRDNVIDFMEFVAAVH 81

  Fly   107 TLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRK 171
            .:|||::.:||:|:||:||.:.:|::.|.|:..:|..:.:|...|.:.     ...:..||:|..
Zfish    82 LVLRGNLEDRLKWSFKVYDRDENGKLDRQEVIHVIRILCKLKKNRINM-----TPVEICDRIFEL 141

  Fly   172 LDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            ||.|.||.|::.||||...||..:...|::..|
Zfish   142 LDENNDGQISLSEFLEGAEKDAWIMDLLKLDTN 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 48/149 (32%)
guca1gNP_001011660.1 EF-hand_8 30..80 CDD:290545 14/49 (29%)
EFh 59..117 CDD:238008 20/57 (35%)
EFh 91..158 CDD:238008 25/71 (35%)
EF-hand_7 92..157 CDD:290234 23/69 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.