DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and kcnip1b

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_021334841.1 Gene:kcnip1b / 494089 ZFINID:ZDB-GENE-041212-57 Length:225 Species:Danio rerio


Alignment Length:195 Identity:100/195 - (51%)
Similarity:141/195 - (72%) Gaps:1/195 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 EEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPH 74
            ::|..|||.|.|... |..||.|..||.|:|||::|:|||||.|||.|||:||.||.|||:||||
Zfish    30 DKVDDELEMTMVCHR-PEGLEQLEAQTNFSKQELQVLYRGFKNECPSGVVNEDTFKHIYAQFFPH 93

  Fly    75 GNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSE 139
            |::|.||||:|.|||...||:|.|.|.::.|||||||:|.::|.|||.|||:|.||.|::.|::|
Zfish    94 GDASTYAHYLFHAFDTRNNGSIKFEDFVMGLSTLLRGTVRDKLEWTFHLYDINKDGFINKEEMTE 158

  Fly   140 IILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            |:.||:::||:..:........:..||..|.|:|.|:||::|:|||:.||.:|:.:.||:|:|:|
Zfish   159 IVRAIYDMMGKYTYPALKGDVPKAHVDAFFEKMDKNKDGVVTLEEFVLACQEDENMMRSMQLFEN 223

  Fly   205  204
            Zfish   224  223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 87/162 (54%)
kcnip1bXP_021334841.1 FRQ1 48..205 CDD:227455 84/156 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576095
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3687
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm24851
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5210
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.