DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and AgaP_AGAP006178

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_316241.3 Gene:AgaP_AGAP006178 / 4576643 VectorBaseID:AGAP006178 Length:171 Species:Anopheles gambiae


Alignment Length:163 Identity:35/163 - (21%)
Similarity:65/163 - (39%) Gaps:20/163 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KFTKQEIRVMYRGFKTECPE--GVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFR 99
            :.:|.:::|:...|.....|  |.:..|....| .:...|..|......|.:.:|.:.:|.:.|.
Mosquito    19 ELSKDQLKVLRDAFNAFDKEKTGSIPTDVVGTI-LELLGHKLSEEELDEVIEEYDEDESGQLEFE 82

  Fly   100 DLLVTLSTLLR-----GSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDR 159
            :.:...|..:.     .::.:.||..|.:||.:..|.:...|...|   :.||.|..|.:..|| 
Mosquito    83 EFVALASNYVEPEEDYEALRKELREVFMMYDKDAKGYLPVEEFKAI---LRELDGAVPEEELDD- 143

  Fly   160 KARDQVDRVFRKLDLNQDGIITIEEFLEACLKD 192
                    :..::|.:..|.:..|||:|....|
Mosquito   144 --------IVDEIDADGSGTVDFEEFMEVMTAD 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 34/161 (21%)
AgaP_AGAP006178XP_316241.3 FRQ1 13..168 CDD:227455 34/161 (21%)
EFh 28..89 CDD:298682 11/61 (18%)
EFh 104..166 CDD:238008 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.