DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CG14362

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_650320.1 Gene:CG14362 / 41695 FlyBaseID:FBgn0038186 Length:206 Species:Drosophila melanogaster


Alignment Length:190 Identity:41/190 - (21%)
Similarity:78/190 - (41%) Gaps:45/190 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 VPKPIPVALEDLCRQTKFTKQEIRVMYRGFKT-----ECPEGVVHEDCFKDIYA------KFFPH 74
            ||:.|   :..|...|..::.:|:.:|..|..     :.|...:|:..|   |:      ...|.
  Fly    15 VPQEI---MNTLRMNTALSRSQIKYLYIRFHQFSGGGKDPPSHLHKYNF---YSGLLQLNPLLPT 73

  Fly    75 GNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVY-----------ERLRWTFKLYDLNG 128
            ..:|::.:.|          .|:|.|..:.|||....|:.           ::||..|.:||.|.
  Fly    74 ILNSMFGNKV----------TITFVDFALFLSTFQAHSLKTSNELKNVMMDKKLRLIFNMYDNNK 128

  Fly   129 DGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEA 188
            ||||::.:|   ::.:|:|....    .|..:....|:.:.:::|......|..::|.:|
  Fly   129 DGRITKYDL---VVVVHKLFSNL----LDHVQIMRIVNTIMKEMDHTDSNQIMFQDFCKA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 38/182 (21%)
CG14362NP_650320.1 EFh 116..183 CDD:238008 19/73 (26%)
EF-hand_7 117..182 CDD:290234 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.