DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CG7646

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001287124.1 Gene:CG7646 / 40187 FlyBaseID:FBgn0036926 Length:186 Species:Drosophila melanogaster


Alignment Length:172 Identity:60/172 - (34%)
Similarity:109/172 - (63%) Gaps:3/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCN 93
            :|.|...|::.:..|:..|:|||.:||.|.:....|.|:|..|||.||:..:..:||:.||::.|
  Fly    15 MEFLKTHTRYDEATIKEWYKGFKQDCPNGRLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMDKN 79

  Fly    94 GAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGR-RPHQPED 157
            |.|.|::.|:.:.....|:..|:|:|.|::||::|:|.|...|:::|:.||::::|. ..::|.|
  Fly    80 GYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNRPAD 144

  Fly   158 DRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSL 199
              .|.::...:|.|:|.|.||.:|.:|||:.||:|:.:::.|
  Fly   145 --SAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 58/163 (36%)
CG7646NP_001287124.1 FRQ1 18..178 CDD:227455 57/161 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442275
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I2330
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
87.990

Return to query results.
Submit another query.