DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and hpcal1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_957458.1 Gene:hpcal1 / 394139 ZFINID:ZDB-GENE-040426-1242 Length:193 Species:Danio rerio


Alignment Length:175 Identity:71/175 - (40%)
Similarity:112/175 - (64%) Gaps:0/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDV 90
            |..|.||...|:||..|::..||||..:||.|.:..:.||.|||.|||:|::|.:|.:||:.||.
Zfish    10 PEVLNDLRENTEFTDHELQEWYRGFLKDCPSGHLTVEEFKKIYANFFPYGDASKFAEHVFRTFDT 74

  Fly    91 NCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQP 155
            |.:..|.||:.::.||...||.:.::|||.|.:|||:|:|.|||.|:.||:.||::::......|
Zfish    75 NSDATIDFREFIIALSVTSRGGLEQKLRWAFSMYDLDGNGYISRAEMLEIVQAIYKMVSSVMKMP 139

  Fly   156 EDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQ 200
            ||:.....:.|::||::|.:.||.:::|||::....|..:.|.||
Zfish   140 EDESTPEKRTDKIFRQMDTDNDGRLSLEEFIKGAKSDPSIVRLLQ 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 66/162 (41%)
hpcal1NP_957458.1 FRQ1 13..179 CDD:227455 67/165 (41%)
EFh <36..89 CDD:298682 22/52 (42%)
EFh 65..126 CDD:238008 28/60 (47%)
EFh 100..174 CDD:238008 29/73 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576105
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.