DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and kcnip3a

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_005169145.1 Gene:kcnip3a / 393792 ZFINID:ZDB-GENE-040426-1791 Length:259 Species:Danio rerio


Alignment Length:179 Identity:87/179 - (48%)
Similarity:131/179 - (73%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDV 90
            |..||.|..||||||:|::.:|||||.|||.|:|.|:.||.||::|||.|:::.|||::|.|||:
Zfish    79 PEGLEQLQAQTKFTKKELQSLYRGFKNECPSGLVDEETFKTIYSQFFPQGDATTYAHFLFNAFDL 143

  Fly    91 NCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQP 155
            :.||:|.|.|.::.||.||||:|.|:|.|.|.|||:|.||.|::.|:..|:.:|:::|||..:..
Zfish   144 DRNGSIRFEDFVIGLSVLLRGTVTEKLNWAFNLYDINKDGYITKEEMLLIMKSIYDMMGRYTYPS 208

  Fly   156 EDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            ..|....:.|::.|:|:|.|:||::|||||:|.|.||:.:..|:|:|:|
Zfish   209 VRDEAPSEHVEKFFQKMDRNRDGVVTIEEFIETCQKDENIMNSMQLFEN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 80/162 (49%)
kcnip3aXP_005169145.1 FRQ1 82..248 CDD:227455 82/165 (50%)
EF-hand_8 108..155 CDD:290545 24/46 (52%)
EFh 133..195 CDD:238008 32/61 (52%)
EFh 169..240 CDD:238008 29/70 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.