DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and kcnip3b

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_957076.1 Gene:kcnip3b / 393755 ZFINID:ZDB-GENE-040426-1752 Length:259 Species:Danio rerio


Alignment Length:203 Identity:92/203 - (45%)
Similarity:143/203 - (70%) Gaps:1/203 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASPPESPIEEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKD 66
            ::.|:...:....|||.:.| :..|..||.|..||:||::|::.:|||||.|||.|:|.|:.||.
Zfish    56 SAAPQGSNDSTDSELELSAV-RHQPEGLEQLQAQTQFTRKELQSLYRGFKNECPSGLVDEETFKS 119

  Fly    67 IYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGR 131
            ||::|||.|:::.|||::|.|||::.||:|.|.|.::.||.||||||.|:|||.|.|||:|.||.
Zfish   120 IYSQFFPQGDATTYAHFLFNAFDMDRNGSIRFEDFVIGLSVLLRGSVTEKLRWAFNLYDINKDGY 184

  Fly   132 ISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVT 196
            |::.|:..|:.:|:::|||.......|..|.:.|::.|:|:|.|:||::|:|||:|.|.||:.:.
Zfish   185 ITKEEMLAIMKSIYDMMGRYTSPCVKDDAAFEHVEKFFQKMDRNRDGVVTLEEFIETCQKDENIM 249

  Fly   197 RSLQMFDN 204
            .|:|:|:|
Zfish   250 SSMQLFEN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 80/162 (49%)
kcnip3bNP_957076.1 FRQ1 82..248 CDD:227455 82/165 (50%)
EF-hand_8 108..155 CDD:290545 24/46 (52%)
EFh 133..195 CDD:238008 34/61 (56%)
EFh 169..240 CDD:238008 30/70 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576130
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3687
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm24851
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.