DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and cib2

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_957000.1 Gene:cib2 / 393679 ZFINID:ZDB-GENE-040426-1663 Length:187 Species:Danio rerio


Alignment Length:173 Identity:37/173 - (21%)
Similarity:74/173 - (42%) Gaps:26/173 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 TKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKF-------FPHGNSSLYAHYVFKAFDVNCN 93
            |.||::||..::..:....|. :|..|...|...|.       .|....:.:.:.:.::|..:..
Zfish    20 TFFTRKEILRLHGRYHELAPH-LVPMDYTNDPDVKVPLALIVNMPELKENPFRNRIVESFSEDGQ 83

  Fly    94 GAISFRDLLVTLSTLLRGSVYE-RLRWTFKLYDLNGDGRISRGELSEII--LAIHELMGRRPHQP 155
            |.:||.|.:...|.|...:..| :..:.||:||.|.|..|.:.:|.:.:  |...||      .|
Zfish    84 GNLSFNDFVDMFSVLSEMAPRELKAIYAFKIYDFNVDNYICKEDLEKTLNKLTKEEL------TP 142

  Fly   156 EDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRS 198
            |:....   .::...:.||:.|..::..:|      :::::|:
Zfish   143 EEVNLV---CEKAIEEADLDGDNKLSFADF------ENMISRA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 36/165 (22%)
cib2NP_957000.1 EFh 107..174 CDD:238008 17/81 (21%)
EF-hand_7 111..173 CDD:290234 17/76 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.