DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CG3565

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_611942.1 Gene:CG3565 / 37933 FlyBaseID:FBgn0035034 Length:244 Species:Drosophila melanogaster


Alignment Length:108 Identity:23/108 - (21%)
Similarity:47/108 - (43%) Gaps:17/108 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 FRDLLVTLSTLLR-GSVY------ERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQP 155
            |.|..:.|.:.:| .:||      .::.:.|.:|| ..|.:...||      .:...:|:.....
  Fly    99 FSDKHIHLESFVRLFTVYFTKDLQLKMEFAFSVYD-KSDSKQLNGE------QVGFFVGKFFESE 156

  Fly   156 EDDRKAR---DQVDRVFRKLDLNQDGIITIEEFLEACLKDDLV 195
            ::|....   |..:.:|.|.||::|..|.::|:.|...:..::
  Fly   157 DEDESIELRLDMKEMLFLKFDLDKDTNIGVDEYYEVVRRQPML 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 23/103 (22%)
CG3565NP_611942.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442296
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.