DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Cib2

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_611523.3 Gene:Cib2 / 37363 FlyBaseID:FBgn0034558 Length:189 Species:Drosophila melanogaster


Alignment Length:177 Identity:41/177 - (23%)
Similarity:79/177 - (44%) Gaps:26/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHE-------------DCFKDIYAKFFPHGNSSLY 80
            |:|....|.||::||..:::.|:...|:.|..:             :|.:.:     |....:.:
  Fly    13 LDDYQDCTFFTRKEILRVHKRFRELRPDLVPRQMTEGQASSVKVPCECIEKM-----PELRENPF 72

  Fly    81 AHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYE-RLRWTFKLYDLNGDGRISRGELSEIILAI 144
            ...:.:||..:..|.:||.|.|..||.....:..: ::.:.||:||.:.||.|...:|...:.. 
  Fly    73 RRRICEAFSRDGQGNLSFEDFLDALSVFSEQAPRDIKVFYAFKIYDFDQDGFIGHADLMSCLTT- 136

  Fly   145 HELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLK 191
               |.:....||:.::.   .|:|..:.|::.||.::|.||....|:
  Fly   137 ---MTKNELSPEEHQQI---ADKVIEEADVDGDGKLSILEFEHVILR 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 41/177 (23%)
Cib2NP_611523.3 FRQ1 20..180 CDD:227455 39/170 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
21.910

Return to query results.
Submit another query.