DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and guca1c

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_919374.1 Gene:guca1c / 373099 ZFINID:ZDB-GENE-030829-1 Length:188 Species:Danio rerio


Alignment Length:164 Identity:48/164 - (29%)
Similarity:87/164 - (53%) Gaps:7/164 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 QEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTL 105
            :::...|..|..|.|.|::.....|::.........:|.|...||..||::.:|.|.|.:.:..:
Zfish    14 EDMHYWYNKFMRESPSGLITLFELKNMLEMQGMTEEASSYVDQVFFTFDMDGDGYIDFVEYIAAV 78

  Fly   106 STLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFR 170
            |.||:|.:.::|:|.|||:|.:|:|:|.|.|:..|..||.::. |....|.|     |.|..::.
Zfish    79 SLLLKGEINQKLKWYFKLFDQDGNGKIDRDEMETIFKAIQDIT-RSYEIPPD-----DIVSLIYE 137

  Fly   171 KLDLNQDGIITIEEFLEACLK-DDLVTRSLQMFD 203
            ::|:|.:|.:|:|||:....: .|::....:|.|
Zfish   138 RIDVNNEGELTLEEFITGAKEHPDIMEMLTKMMD 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 45/151 (30%)
guca1cNP_919374.1 FRQ1 6..162 CDD:227455 45/153 (29%)
EFh 53..110 CDD:238008 22/56 (39%)
EFh 89..157 CDD:238008 26/73 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.