DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and rcvrn2

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_956258.1 Gene:rcvrn2 / 335650 ZFINID:ZDB-GENE-030131-7590 Length:193 Species:Danio rerio


Alignment Length:167 Identity:50/167 - (29%)
Similarity:96/167 - (57%) Gaps:2/167 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCN 93
            ||||...|||::.|:...|..|:.:||.|.:..:.||.||.:|||..:::.||.:||::||.|.:
Zfish    14 LEDLKLNTKFSENELSQWYENFQKQCPSGRITPEEFKKIYERFFPECDTTSYAQHVFRSFDTNDD 78

  Fly    94 GAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQ--PE 156
            |.:.|::.::.|.....|....:|.|.|.|:|::.:|.|::.|::||..||.:|:.:...:  |.
Zfish    79 GTLDFKEYIIALHMTSTGKTERKLEWAFSLFDVDKNGYITKSEVAEICQAIFKLIPKEDQESLPA 143

  Fly   157 DDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDD 193
            |:.....:.|:::...:...:..:...||::..|:::
Zfish   144 DENTPEKRADKLWSYFNKKDNERLAEGEFIQGILENE 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 50/164 (30%)
rcvrn2NP_956258.1 FRQ1 14..181 CDD:227455 50/167 (30%)
EF-hand_8 40..87 CDD:290545 18/46 (39%)
EFh 65..125 CDD:238008 19/59 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576132
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.