DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CG44422

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_572699.2 Gene:CG44422 / 32063 FlyBaseID:FBgn0265595 Length:746 Species:Drosophila melanogaster


Alignment Length:221 Identity:106/221 - (47%)
Similarity:147/221 - (66%) Gaps:15/221 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELEHTRVP-KPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHG-NS 77
            |||....| :..|.:|..|.|.|:||:.||:.:|||||.|||.|||.||.||.||::|||.| |.
  Fly   243 ELEEFETPARYRPDSLSALSRATRFTEDEIKRIYRGFKAECPTGVVKEDTFKVIYSQFFPQGANP 307

  Fly    78 SLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIIL 142
            :|||||||...|.:.:|.:||.|.:..||.|.||||.|:|||||.|||:||||.|:|.|:::|:.
  Fly   308 TLYAHYVFNTLDQDHSGIVSFEDFVQGLSILSRGSVEEKLRWTFSLYDINGDGFITREEMTDIVT 372

  Fly   143 AIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSL-----QMF 202
            ||:|||||.|.:..::.|.:.:|:::|:|:|.|:||::|:|||||||..||.::||:     :..
  Fly   373 AIYELMGRLPDECPEEEKIKGKVEQIFQKMDTNRDGVVTLEEFLEACRNDDAISRSMSYTVPRRR 437

  Fly   203 DNDLXXQEGEL--------EPGLRNS 220
            .:.|..|:..|        ||..|.|
  Fly   438 RHQLSAQQQHLQHQKHQQQEPEKRKS 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 90/163 (55%)
CG44422NP_572699.2 FRQ1 254..419 CDD:227455 89/164 (54%)
EFh 310..372 CDD:238008 35/61 (57%)
EFh 346..418 CDD:238008 37/71 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4318
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143871at50557
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - mtm1040
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5210
SonicParanoid 1 1.000 - - X31
98.950

Return to query results.
Submit another query.