DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CG2256

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_572437.2 Gene:CG2256 / 31727 FlyBaseID:FBgn0029995 Length:324 Species:Drosophila melanogaster


Alignment Length:196 Identity:49/196 - (25%)
Similarity:91/196 - (46%) Gaps:30/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PVALEDLCRQTKFTKQEIRVM---YRGFKTECP----------------------EGVVHEDCFK 65
            |..|:.|.::|:|||.|:..:   ||...:.|.                      || :....|:
  Fly   110 PKLLDSLRKKTRFTKDELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEG-IDRIVFR 173

  Fly    66 DIYAKFFPHGNSSLYAHYVFKAFDVNCNG-AISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGD 129
            ::....|......:....:|.::|....| .:.....|:.|||.|||:..||..:.|::||||.|
  Fly   174 ELLHSTFDIVTEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTPAERAAFCFRVYDLNTD 238

  Fly   130 GRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDL 194
            |.|::.|:..:   :...:.::|...:.|...:|.|:.|.:|.||::||.:::|:|:.....:.|
  Fly   239 GFITKDEMFTL---LRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMGTVTAEPL 300

  Fly   195 V 195
            :
  Fly   301 L 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 47/188 (25%)
CG2256NP_572437.2 EFh 228..292 CDD:238008 20/66 (30%)
EF-hand_7 229..292 CDD:290234 20/65 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
43.940

Return to query results.
Submit another query.