DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Guca1b

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001101668.1 Gene:Guca1b / 316218 RGDID:1308191 Length:201 Species:Rattus norvegicus


Alignment Length:187 Identity:62/187 - (33%)
Similarity:103/187 - (55%) Gaps:30/187 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EIRVMYRGFKTECPEGV--VHEDCFKDIYAKFFP-HGN--SSLYAHYVFKAFDVNCNGAISFRDL 101
            |::..|:.|..|||.|.  :||      :.:||. .||  ::.|...:|:|||.|.:..|.|.:.
  Rat    20 ELQEWYKKFVVECPSGTLFMHE------FKRFFKVTGNEEATQYVEGMFRAFDKNGDNTIDFLEY 78

  Fly   102 LVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQ-- 164
            :..|:.:|||::..:|:||||:||.:.:|.|.|.||.:|:.||::|  ::..:.|.|.:.:.|  
  Rat    79 VAALNLVLRGTLEHKLKWTFKIYDKDRNGCIDRLELLDIVEAIYKL--KKACRAELDLEQQGQLL 141

  Fly   165 -----VDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDNDLXXQEGELEPG 216
                 |||:|..:|.|.||.:::.||:|...:|..|.:.|||          ::.||
  Rat   142 TPEEVVDRIFLLVDENGDGQLSLTEFIEGARRDKWVMKMLQM----------DVNPG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 55/161 (34%)
Guca1bNP_001101668.1 FRQ1 15..175 CDD:227455 55/162 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337000
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.