DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and KCNIP1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001265268.1 Gene:KCNIP1 / 30820 HGNCID:15521 Length:241 Species:Homo sapiens


Alignment Length:226 Identity:104/226 - (46%)
Similarity:143/226 - (63%) Gaps:29/226 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PPESPIEEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIY 68
            |.:..||:   |||.|.|... |..||.|..||.|||:|::|:|||||.|||.|||:||.||.||
Human    18 PSKDKIED---ELEMTMVCHR-PEGLEQLEAQTNFTKRELQVLYRGFKNECPSGVVNEDTFKQIY 78

  Fly    69 AKFFPHG-------------------------NSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTL 108
            |:|||||                         ::|.||||:|.|||....|::.|.|.:..||.|
Human    79 AQFFPHGALPCLEGSPCVEFLPPSPALLFCLVDASTYAHYLFNAFDTTQTGSVKFEDFVTALSIL 143

  Fly   109 LRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLD 173
            |||:|:|:|||||.|||:|.||.|::.|:.:|:.||:::||:..:....:...|..||..|:|:|
Human   144 LRGTVHEKLRWTFNLYDINKDGYINKEEMMDIVKAIYDMMGKYTYPVLKEDTPRQHVDVFFQKMD 208

  Fly   174 LNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            .|:|||:|::||||:|.:||.:.||||:|.|
Human   209 KNKDGIVTLDEFLESCQEDDNIMRSLQLFQN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 87/187 (47%)
KCNIP1NP_001265268.1 FRQ1 39..230 CDD:227455 89/190 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143240
Domainoid 1 1.000 96 1.000 Domainoid score I7327
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22824
Inparanoid 1 1.050 213 1.000 Inparanoid score I3639
Isobase 1 0.950 - 0 Normalized mean entropy S788
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm40506
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5210
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1312.880

Return to query results.
Submit another query.