DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and KCNIP3

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_038462.1 Gene:KCNIP3 / 30818 HGNCID:15523 Length:256 Species:Homo sapiens


Alignment Length:190 Identity:97/190 - (51%)
Similarity:138/190 - (72%) Gaps:1/190 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSL 79
            |||.:.| :..|..|:.|..||||||:|::.:|||||.|||.|:|.||.||.|||:|||.|:::.
Human    66 ELELSTV-RHQPEGLDQLQAQTKFTKKELQSLYRGFKNECPTGLVDEDTFKLIYAQFFPQGDATT 129

  Fly    80 YAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAI 144
            |||::|.|||.:.||||.|.|.:|.||.||||:|:|:|:|.|.|||:|.||.|::.|:..|:.:|
Human   130 YAHFLFNAFDADGNGAIHFEDFVVGLSILLRGTVHEKLKWAFNLYDINKDGYITKEEMLAIMKSI 194

  Fly   145 HELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            :::|||..:....:....:.|:|.|.|:|.||||::|||||||||.||:.:..|:|:|:|
Human   195 YDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQKDENIMSSMQLFEN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 86/162 (53%)
KCNIP3NP_038462.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
FRQ1 81..245 CDD:227455 87/163 (53%)
EFh 130..192 CDD:238008 34/61 (56%)
EFh 166..238 CDD:238008 31/71 (44%)
Interaction with KCND2. /evidence=ECO:0000250 243..256 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143264
Domainoid 1 1.000 96 1.000 Domainoid score I7327
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 213 1.000 Inparanoid score I3639
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm40506
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5210
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.