DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Efcab1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001100400.1 Gene:Efcab1 / 301957 RGDID:1594548 Length:212 Species:Rattus norvegicus


Alignment Length:201 Identity:52/201 - (25%)
Similarity:104/201 - (51%) Gaps:16/201 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KPIPVALEDLCRQTK-FTKQEIR---VMYRGFKTECPE--GVV---HEDCFKDIYAKFFPHGNSS 78
            |.:....:.|.:..| |.|.|::   .::.....:.||  |||   ..:.|::|....|.. ...
  Rat     4 KKLQKLTDTLTKSCKHFNKFEVKCLITLFYNLVGDVPEKPGVVTGLDRNVFRNILHVTFGM-TDD 67

  Fly    79 LYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILA 143
            :....||:.||.:.:|.||..:.:..||..|||::.|::::.|:::||||||.||:.|:..::. 
  Rat    68 MIMDRVFRGFDRDNDGCISVSEWVHGLSLFLRGTLDEKMKYCFEVFDLNGDGFISKEEMFHMLK- 131

  Fly   144 IHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDNDLXX 208
             :.|: ::|.:.:.|...:|.|:...:|:|.:.||.::..::..|..::.|:   |:.|...|..
  Rat   132 -NSLL-KQPSEEDPDEGIKDLVEITLKKMDHDHDGKLSFVDYETAVREETLL---LEAFGPCLPD 191

  Fly   209 QEGELE 214
            .:.::|
  Rat   192 PKRQME 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 46/171 (27%)
Efcab1NP_001100400.1 EF-hand_7 70..130 CDD:290234 23/59 (39%)
EFh 72..131 CDD:238008 23/58 (40%)
EFh 105..168 CDD:238008 19/65 (29%)
EF-hand_7 106..175 CDD:290234 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336998
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.