DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Cib2

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001015010.1 Gene:Cib2 / 300719 RGDID:1308718 Length:187 Species:Rattus norvegicus


Alignment Length:204 Identity:44/204 - (21%)
Similarity:81/204 - (39%) Gaps:70/204 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 RQTKFTKQEIRVMYRGFKTECPEGVVHEDCF----KDI---YAKFF------------------- 72
            :||.||::::.              .::||.    |||   :|:|:                   
  Rat     4 KQTIFTEEQLD--------------NYQDCTFFNKKDILKLHARFYELAPNLVPMDYRKSPIVHV 54

  Fly    73 --------PHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYE-RLRWTFKLYDLNG 128
                    |....:.:...:.:||..:..|.::|.|.:...|.|...:..| :..:.||:||.|.
  Rat    55 PMSLIIQMPELRENPFKERIVEAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNT 119

  Fly   129 DGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQV----DRVFRKLDLNQDGIITIEEFLEAC 189
            |..|.:.:| |:.||       |..:.|.|   .|:|    |:|..:.||:.||.:...:|    
  Rat   120 DNFICKEDL-ELTLA-------RLTKSELD---EDEVVLVCDKVIEEADLDGDGKLGFADF---- 169

  Fly   190 LKDDLVTRS 198
              :|::.::
  Rat   170 --EDMIAKA 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 43/196 (22%)
Cib2NP_001015010.1 FRQ1 <68..178 CDD:227455 32/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.