DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and GUCA1B

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_002089.4 Gene:GUCA1B / 2979 HGNCID:4679 Length:200 Species:Homo sapiens


Alignment Length:164 Identity:59/164 - (35%)
Similarity:92/164 - (56%) Gaps:5/164 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLS 106
            |::..|:.|..|||.|.:....||..: |......:|.|...:|:|||.|.:..|.|.:.:..|:
Human    20 ELQEWYKKFVMECPSGTLFMHEFKRFF-KVTDDEEASQYVEGMFRAFDKNGDNTIDFLEYVAALN 83

  Fly   107 TLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMG--RRPHQPEDDR--KARDQVDR 167
            .:|||::..:|:||||:||.:|:|.|.|.||..|:..|::|..  ||..|.|..:  ...:.|||
Human    84 LVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQGQLLTPEEVVDR 148

  Fly   168 VFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQM 201
            :|..:|.|.||.:::.||:|...:|..|.:.|||
Human   149 IFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQM 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 54/153 (35%)
GUCA1BNP_002089.4 FRQ1 20..174 CDD:227455 54/154 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143267
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.