DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Kcnip4

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_852030.1 Gene:Kcnip4 / 259243 RGDID:708539 Length:250 Species:Rattus norvegicus


Alignment Length:204 Identity:97/204 - (47%)
Similarity:149/204 - (73%) Gaps:5/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASPP-ESPIEEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFK 65
            :||. ::.:|:   |||...| :..|.|||.|..|:||||:|::::|||||.|||.|||:|:.||
  Rat    49 SSPAIQNSVED---ELEMATV-RHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFK 109

  Fly    66 DIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDG 130
            :||::|||.|:|:.|||::|.|||.:.|||:||.|.:..||.||||:|.|:|.|.|.|||:|.||
  Rat   110 EIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDG 174

  Fly   131 RISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLV 195
            .|::.|:.:|:.||:::||:..:....:...|..|:..|:|:|.|:||::||:||:|:|.||:.:
  Rat   175 YITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENI 239

  Fly   196 TRSLQMFDN 204
            .||:|:|:|
  Rat   240 MRSMQLFEN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 81/162 (50%)
Kcnip4NP_852030.1 KIS. /evidence=ECO:0000250 2..44
FRQ1 80..239 CDD:227455 79/158 (50%)
Interaction with KCND2. /evidence=ECO:0000250 237..250 5/12 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336982
Domainoid 1 1.000 96 1.000 Domainoid score I7128
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 210 1.000 Inparanoid score I3579
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1513542at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm44648
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.900

Return to query results.
Submit another query.