DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Duox2

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001349684.1 Gene:Duox2 / 214593 MGIID:3036280 Length:1545 Species:Mus musculus


Alignment Length:128 Identity:33/128 - (25%)
Similarity:61/128 - (47%) Gaps:14/128 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILA 143
            ::...:|...|.:.||.||||:.|..|...::||..::.|..|.:|||:|:|.:|:.|...::.:
Mouse   822 MFVESMFSLADKDGNGYISFREFLDILVVFMKGSSEDKSRLMFTMYDLDGNGFLSKDEFFTMMRS 886

  Fly   144 IHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDNDL 206
            ..|:......:.:    ..:.|:.:||:........:|.|:| ...|:|         .|:||
Mouse   887 FIEISNNCLSKAQ----LAEVVESMFRESGFQDKEELTWEDF-HFMLRD---------HDSDL 935

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 29/112 (26%)
Duox2NP_001349684.1 dual_peroxidase_like 38..594 CDD:188652
EFh 824..885 CDD:238008 21/60 (35%)
EFh 861..919 CDD:238008 13/61 (21%)
Ferric_reduct 1085..1229 CDD:366815
NOX_Duox_like_FAD_NADP 1271..1545 CDD:99783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.