DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Rcvrn

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_033064.1 Gene:Rcvrn / 19674 MGIID:97883 Length:202 Species:Mus musculus


Alignment Length:176 Identity:59/176 - (33%)
Similarity:103/176 - (58%) Gaps:6/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCN 93
            ||:|...||||::|:...|:.|..|||.|.:....|:.||:||||..:...||.:||::||.|.:
Mouse    14 LEELQLNTKFTEEELSAWYQSFLKECPSGRITRQEFESIYSKFFPDSDPKAYAQHVFRSFDANSD 78

  Fly    94 GAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQ---- 154
            |.:.|::.::.|.....|...::|.|.|.|||::|:|.||:.|:.||::||.:::  :|..    
Mouse    79 GTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMI--KPEDVKLL 141

  Fly   155 PEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQ 200
            |:|:.....:.::::......:|..:|.|||:|..|.:..:.|.:|
Mouse   142 PDDENTPEKRAEKIWAFFGKKEDDKLTEEEFIEGTLANKEILRLIQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 57/166 (34%)
RcvrnNP_033064.1 FRQ1 14..182 CDD:227455 57/169 (34%)
EFh <37..90 CDD:298682 20/52 (38%)
EFh 65..127 CDD:238008 24/61 (39%)
EFh 101..175 CDD:238008 23/75 (31%)
Interaction with GRK1. /evidence=ECO:0000250|UniProtKB:P21457 189..192
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833443
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.