DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Ppp3r1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_077779.2 Gene:Ppp3r1 / 19058 MGIID:107172 Length:170 Species:Mus musculus


Alignment Length:103 Identity:31/103 - (30%)
Similarity:56/103 - (54%) Gaps:8/103 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 VFKAFDVNCNGAISFRDLLVTLSTL-LRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHEL 147
            |...||.:.||.:.|::.:..:|.. ::|...::||:.|::||::.||.||.|||.::   :..:
Mouse    58 VIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQV---LKMM 119

  Fly   148 MGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEF 185
            :|..    ..|.:.:..||:.....|.:.||.|:.|||
Mouse   120 VGNN----LKDTQLQQIVDKTIINADKDGDGRISFEEF 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 31/103 (30%)
Ppp3r1NP_077779.2 FRQ1 13..157 CDD:227455 31/103 (30%)
Calcineurin A binding. /evidence=ECO:0000269|PubMed:26794871 131..136 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.