DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and ncs-5

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001256829.1 Gene:ncs-5 / 183792 WormBaseID:WBGene00008307 Length:288 Species:Caenorhabditis elegans


Alignment Length:173 Identity:42/173 - (24%)
Similarity:88/173 - (50%) Gaps:7/173 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFF-PHGNSSLYAHYVFKAFD 89
            |.:||.|.::|:|:.:.|:.||..||.|.|.|.:.|:.|:::.|... |...:..|...:|.||.
 Worm    95 PPSLEQLTQRTQFSPKWIKYMYAKFKNESPTGKMKEEEFRNLLASIIAPEKATDQYISRLFTAFA 159

  Fly    90 VNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRI----SRGELSEIILAIHELMGR 150
            ......|:|.:||.:||.:...:.....:||.:|....|:|..    :..:.::.:..::|  |:
 Worm   160 GVDKKTITFENLLDSLSHVQPQTAETNAKWTMRLITGGGEGDCFGYSAFLDFTQSVFQLNE--GK 222

  Fly   151 RPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDD 193
            ...:..:....:.:..::|.:||.::||::|.::.:....|::
 Worm   223 SGGEEINKESVQQRATKIFAELDCDRDGLVTYDDMIRFFQKNN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 40/167 (24%)
ncs-5NP_001256829.1 FRQ1 97..261 CDD:227455 40/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.