DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and ncs-7

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001360662.1 Gene:ncs-7 / 182694 WormBaseID:WBGene00015867 Length:239 Species:Caenorhabditis elegans


Alignment Length:210 Identity:66/210 - (31%)
Similarity:109/210 - (51%) Gaps:9/210 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EVVYELE-HTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPH 74
            |:..||: ...:.:..|.:::.|...|.|:|:||:.:||.||...|.|.|..:.|:.|||..||:
 Worm    37 EMEEELDTQPAIERQTPPSIDYLIEITNFSKREIQQLYRSFKELWPIGTVDLEQFQLIYASIFPN 101

  Fly    75 GNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSE 139
            |:|..||..|||..|.|..|.::|.|.:...|.:.:|::.|||.|.|.|||.|..|.::..|:..
 Worm   102 GDSKGYAELVFKNIDQNRVGTVTFLDFITNYSKIAKGTLDERLDWIFTLYDTNRCGFLAYNEIFH 166

  Fly   140 IILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            ::.:::::|.............|..|..||:.|::..:|.::..|||:.|..|..:..|:::|  
 Worm   167 VVKSMYQMMDSSLKPAVLATICRQHVKIVFKNLNIANNGKVSKAEFLQRCRSDSDILASMELF-- 229

  Fly   205 DLXXQEGELEPGLRN 219
                  |....||.|
 Worm   230 ------GSFSSGLLN 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 55/162 (34%)
ncs-7NP_001360662.1 FRQ1 59..222 CDD:227455 56/162 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159825
Domainoid 1 1.000 68 1.000 Domainoid score I6407
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28990
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.