DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and B0563.7

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_509544.1 Gene:B0563.7 / 182041 WormBaseID:WBGene00015264 Length:229 Species:Caenorhabditis elegans


Alignment Length:203 Identity:44/203 - (21%)
Similarity:93/203 - (45%) Gaps:33/203 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 HTRVPKPIPVALEDLCRQTKFTKQEI---RVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSL 79
            |::..:|     ||:  |.|:|::|:   |.::..|.|: ..|.:..:..|........|.|.:.
 Worm    32 HSQQSQP-----EDI--QMKYTRKELKEYRQLFNMFDTD-GSGAIGNEELKQAMISIGLHANKAE 88

  Fly    80 YAHYVFKAFDVNCNGAISFRDLLVTL---STLLRGSVYERLRWTFKLYDLNGDGRISRGELSEII 141
            ..: |.|..|.:.||.|.|.:....:   ..:::.:..|.:|..|:::|.:.:|.|:..|...|.
 Worm    89 IDN-VIKEVDADGNGEIDFEEFCACMKKSQNIVKSTNEELIRECFEIFDQDRNGIITENEFKYIA 152

  Fly   142 LAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDNDL 206
            ....:.         ||..|    ::|||:||::.:|.::.::|  |.:.:|.:....:   :|:
 Worm   153 KEFGDF---------DDELA----EKVFRELDVSANGHLSADQF--ATIVEDYLLNDPK---HDI 199

  Fly   207 XXQEGELE 214
            ...:.::|
 Worm   200 DTGDSDVE 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 39/168 (23%)
B0563.7NP_509544.1 PTZ00184 46..183 CDD:185504 33/151 (22%)
EFh 52..114 CDD:238008 14/63 (22%)
EFh 88..153 CDD:238008 15/65 (23%)
EFh 128..187 CDD:238008 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.