Sequence 1: | NP_001356889.1 | Gene: | CG5890 / 43126 | FlyBaseID: | FBgn0039380 | Length: | 229 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_509544.1 | Gene: | B0563.7 / 182041 | WormBaseID: | WBGene00015264 | Length: | 229 | Species: | Caenorhabditis elegans |
Alignment Length: | 203 | Identity: | 44/203 - (21%) |
---|---|---|---|
Similarity: | 93/203 - (45%) | Gaps: | 33/203 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 18 HTRVPKPIPVALEDLCRQTKFTKQEI---RVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSL 79
Fly 80 YAHYVFKAFDVNCNGAISFRDLLVTL---STLLRGSVYERLRWTFKLYDLNGDGRISRGELSEII 141
Fly 142 LAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDNDL 206
Fly 207 XXQEGELE 214 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5890 | NP_001356889.1 | FRQ1 | 29..192 | CDD:227455 | 39/168 (23%) |
B0563.7 | NP_509544.1 | PTZ00184 | 46..183 | CDD:185504 | 33/151 (22%) |
EFh | 52..114 | CDD:238008 | 14/63 (22%) | ||
EFh | 88..153 | CDD:238008 | 15/65 (23%) | ||
EFh | 128..187 | CDD:238008 | 18/73 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |