DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and ncs-1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_508186.1 Gene:ncs-1 / 180448 WormBaseID:WBGene00003563 Length:191 Species:Caenorhabditis elegans


Alignment Length:175 Identity:72/175 - (41%)
Similarity:112/175 - (64%) Gaps:0/175 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCN 93
            :.||..||.||::||:..|:||..:||.|::.|..|:.||.:|||.|:.|.:|.:|||.||.|.:
 Worm    13 IRDLAEQTYFTEKEIKQWYKGFVRDCPNGMLTEAGFQKIYKQFFPQGDPSDFASFVFKVFDENKD 77

  Fly    94 GAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDD 158
            |||.|.:.:..||...||::.|:|.|.||||||:.||.|:|.|:..|:.:|::::|.....||::
 Worm    78 GAIEFHEFIRALSITSRGNLDEKLHWAFKLYDLDQDGFITRNEMLSIVDSIYKMVGSSVQLPEEE 142

  Fly   159 RKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFD 203
            .....:|||:||.:|.|.|..:|:|||.|....|..:..:|.:::
 Worm   143 NTPEKRVDRIFRMMDKNNDAQLTLEEFKEGAKADPSIVHALSLYE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 70/162 (43%)
ncs-1NP_508186.1 FRQ1 11..179 CDD:227455 71/165 (43%)
EFh 67..125 CDD:238008 28/57 (49%)
EFh 100..174 CDD:238008 31/73 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28990
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.