DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and chpf-1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001379127.1 Gene:chpf-1 / 179415 WormBaseID:WBGene00014109 Length:195 Species:Caenorhabditis elegans


Alignment Length:183 Identity:44/183 - (24%)
Similarity:84/183 - (45%) Gaps:28/183 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEDLCRQTKFTKQEIRVMYRGFKT--ECPEGVVHEDCFKDI-YAKFFPHGNSSLYAHYVFKAFDV 90
            :|::..:|:|.:.:|..:|..|.:  :..:|.:..|.|.:: .....|.|:..:.|.:..    .
 Worm    14 IEEIMSETEFNRNQIVRLYSRFLSLDKKGQGFLSRDDFLNVPELAVNPLGDRIVDAFFTL----A 74

  Fly    91 NCNG-----AISFRD---LLVTLSTLLR------GSVYERLRWTFKLYDLNGDGRISRGELSEII 141
            :.||     .::||.   :|.....:.|      .|..::|.:.||:||||.:..|:|.|...| 
 Worm    75 SSNGDNEEQQLNFRQFVRILAHFQPISRVKKNALNSRKDKLLFAFKMYDLNKNDYITREEFKVI- 138

  Fly   142 LAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDL 194
              ::.::|......:.|:.|    ||...:.|.::||.|:.:||..|..|.|:
 Worm   139 --LNSMVGANITSDQLDKIA----DRTIEEADADRDGKISFDEFCRAMEKTDI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 42/179 (23%)
chpf-1NP_001379127.1 FRQ1 14..182 CDD:227455 42/178 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.