DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Guca1a

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_032215.2 Gene:Guca1a / 14913 MGIID:102770 Length:202 Species:Mus musculus


Alignment Length:190 Identity:71/190 - (37%)
Similarity:100/190 - (52%) Gaps:24/190 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KFTKQEIRVMYRGFKTECPEG--VVHEDCFKDIYAKFFPHGN----SSLYAHYVFKAFDVNCNGA 95
            :.:..|....|:.|.||||.|  .::|      :.:||...|    :|.|...:|:.||.|.:|.
Mouse    12 ELSSTECHQWYKKFMTECPSGQLTLYE------FRQFFGLKNLSPSASQYVEQMFETFDFNKDGY 70

  Fly    96 ISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDD-- 158
            |.|.:.:..||.:|:|.|.::|||.|||||::|:|.|.|.||..||.||      |...|..|  
Mouse    71 IDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIRAI------RTINPWSDSS 129

  Fly   159 RKARDQVDRVFRKLDLNQDGIITIEEFLEACLKD----DLVTRSLQMFDNDLXXQEGELE 214
            ..|.:..|.||.|:|:|.||.:::|||:|...||    |.:||||.:.....  |.||.|
Mouse   130 MSAEEFTDTVFAKIDINGDGELSLEEFMEGVQKDQMLLDTLTRSLDLTGIVRRLQNGEHE 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 60/162 (37%)
Guca1aNP_032215.2 FRQ1 12..163 CDD:227455 60/162 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833415
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.