DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and Rcvrn

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_543177.2 Gene:Rcvrn / 140936 RGDID:620258 Length:202 Species:Rattus norvegicus


Alignment Length:176 Identity:59/176 - (33%)
Similarity:102/176 - (57%) Gaps:6/176 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCN 93
            ||:|...||||::|:...|:.|..|||.|.:....|:.||:||||..:...||.:||::||.|.:
  Rat    14 LEELQLNTKFTEEELSAWYQSFLKECPSGRITRQEFESIYSKFFPDSDPKAYAQHVFRSFDANSD 78

  Fly    94 GAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQ---- 154
            |.:.|::.::.|.....|...::|.|.|.|||::|:|.||:.|:.||::||.:::  :|..    
  Rat    79 GTLDFKEYVIALHMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVMAIFKMI--KPEDVKNL 141

  Fly   155 PEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQ 200
            |:|:.....:.::::.......|..:|.|||:|..|.:..:.|.:|
  Rat   142 PDDENTPEKRAEKIWAFFGKKDDDKLTEEEFIEGTLANKEILRLIQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 57/166 (34%)
RcvrnNP_543177.2 FRQ1 14..182 CDD:227455 57/169 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166336999
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.