DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and guca1b

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_571946.1 Gene:guca1b / 140431 ZFINID:ZDB-GENE-011128-6 Length:197 Species:Danio rerio


Alignment Length:193 Identity:60/193 - (31%)
Similarity:101/193 - (52%) Gaps:18/193 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCN 93
            |.|...:.:....|::..|:.|..|||.|.:....||..:. ...:..::.|...:|:|||.|.:
Zfish     5 LSDDSDEKEIDVAELQEWYKKFVIECPSGTLFMHDFKSFFG-VTENPEAADYIENMFRAFDKNGD 68

  Fly    94 GAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDD 158
            ..|.|.:.:..|:.:|||.:..:|:||||:||.:|.|.|.:.||.||:.:|:.|  ::....|.|
Zfish    69 NTIDFLEYVAALNLVLRGKLEHKLKWTFKMYDKDGSGCIDKTELKEIVESIYRL--KKACHGELD 131

  Fly   159 RKAR----DQ-VDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDNDLXXQEGELEPG 216
            .:..    || |||:|..:|.|.||.::::||::...:|..|.:.|||          ::.||
Zfish   132 AECNLLTPDQVVDRIFELVDENGDGELSLDEFIDGARRDKWVMKMLQM----------DVNPG 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 53/167 (32%)
guca1bNP_571946.1 FRQ1 1..171 CDD:227455 53/168 (32%)
EFh <29..77 CDD:298682 14/48 (29%)
EFh 55..116 CDD:238008 25/60 (42%)
EFh 91..168 CDD:238008 30/78 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576134
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.