DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and guca1a

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_571945.1 Gene:guca1a / 140430 ZFINID:ZDB-GENE-011128-5 Length:189 Species:Danio rerio


Alignment Length:172 Identity:58/172 - (33%)
Similarity:95/172 - (55%) Gaps:24/172 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 EIRVMYRGFKTECPEG--VVHEDCFKDIYAKFF------PHGNSSLYAHYVFKAFDVNCNGAISF 98
            |:.:.|:.|.||||.|  .:||      :.:||      |..|:  |...:|:.||:|.:|.|.|
Zfish    16 EMHLWYKKFMTECPSGQLTLHE------FKQFFGLRGLDPKANA--YIEQMFRTFDMNKDGYIDF 72

  Fly    99 RDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARD 163
            .:.:..||.::||.:..:|||.|||||::|:|.|.|.||..||.||..:.|    ....:..|.:
Zfish    73 MEYVAALSLVMRGKMEHKLRWYFKLYDVDGNGCIDRYELLNIIKAIRAING----SETQESSAEE 133

  Fly   164 QVDRVFRKLDLNQDGIITIEEFLEACLKD----DLVTRSLQM 201
            ..:|||.::|:|.||.::::||:.....|    :::.:||.:
Zfish   134 FTNRVFERIDINGDGELSLDEFVAGARSDEEFMEVMMKSLDL 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 55/157 (35%)
guca1aNP_571945.1 EFh <27..76 CDD:298682 18/56 (32%)
EFh 54..116 CDD:238008 27/61 (44%)
EF-hand_7 55..115 CDD:290234 25/59 (42%)
EFh 90..160 CDD:238008 29/73 (40%)
EF-hand_7 91..157 CDD:290234 29/69 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.