DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and CIB4

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_011530816.1 Gene:CIB4 / 130106 HGNCID:33703 Length:201 Species:Homo sapiens


Alignment Length:183 Identity:41/183 - (22%)
Similarity:66/183 - (36%) Gaps:49/183 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 DLCRQTKF-TKQEIRVMYRGFKTECPEGVVHEDC-----------------FKDIYAKFFPHGNS 77
            ||.:...| |:.||..::..|...||.|..:::.                 |:|...:.|.|   
Human    31 DLLQALTFLTRNEILCIHDTFLKLCPPGKYYKEATLTMDQVSSLPALRVNPFRDRICRVFSH--- 92

  Fly    78 SLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYE-RLRWTFKLYDLNGDGRISRGELSEII 141
                           .|..||.|:|...|.....:... ::.:.|::||.|.:|.|...:|..||
Human    93 ---------------KGMFSFEDVLGMASVFSEQACPSLKIEYAFRIYDFNENGFIDEEDLQRII 142

  Fly   142 LAIHELMGRRPHQPEDDRK---ARDQVDRVFRKLDLNQDGIITIEEFLEACLK 191
            |.:..         .||..   ..|..:.|..:.||:.|.:::..||..|..|
Human   143 LRLLN---------SDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 41/183 (22%)
CIB4XP_011530816.1 EFh 117..185 CDD:238008 20/76 (26%)
EF-hand_7 118..184 CDD:290234 19/74 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.