DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and AgaP_AGAP001416

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_321718.3 Gene:AgaP_AGAP001416 / 1281761 VectorBaseID:AGAP001416 Length:212 Species:Anopheles gambiae


Alignment Length:191 Identity:45/191 - (23%)
Similarity:88/191 - (46%) Gaps:17/191 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 EHTRVPKPIPVALEDLCRQTKFTKQEIRVM----YRGFKTECPE---GVVHEDCFKDIYAKFFPH 74
            |..|....:...::.|.|.|.||.||:.|:    |:..|.: |:   |.:.......::...|..
Mosquito    11 EEIRFLSKVSGLVKRLARSTHFTHQELEVVLLLYYKILKND-PDAAGGQISRQQLTTVFDTAFGI 74

  Fly    75 GNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSE 139
            .:.::... ::.|.|...:..:|.......:|..:||::.|::::.:::||:..:|.|.|..|. 
Mosquito    75 TDMAVIRR-IYAALDGGNSAHVSMETWARMVSLYVRGTLEEKIQYCYRVYDIQREGMIRRDFLM- 137

  Fly   140 IILAIHELMGRRPHQPED-DRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSL 199
                  .||.....|.|. |...:|.||.:..:|||::||.|:.|::.::.:...|:...|
Mosquito   138 ------VLMRGCVRQEEGVDEAVKDLVDILMTRLDLDRDGAISFEDYRKSVMGTPLLLECL 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 41/170 (24%)
AgaP_AGAP001416XP_321718.3 FRQ1 25..188 CDD:227455 41/171 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.