DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and AgaP_AGAP001760

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_321323.3 Gene:AgaP_AGAP001760 / 1281415 VectorBaseID:AGAP001760 Length:189 Species:Anopheles gambiae


Alignment Length:182 Identity:42/182 - (23%)
Similarity:74/182 - (40%) Gaps:56/182 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QTKFTKQEIRVMYRGF----KTEC-----------PEGVVHEDCFKDIYAKFFPHGN-------- 76
            :|.||..:|..:|..|    :.:|           ||..::..|.:.::: ||...|        
Mosquito    20 ETGFTPNQIERLYSRFTSLDRNDCGTLSREDFLRIPELAINPLCERIVHS-FFADSNDDRVNFRQ 83

  Fly    77 -SSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEI 140
             :.:.||  |:....|....::.|:              |:||:.||:|||:.|..|||.||..|
Mosquito    84 FTRVLAH--FRPIKPNKENRLNSRE--------------EKLRFAFKMYDLDDDETISRDELLNI 132

  Fly   141 ILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQD----GIITIEEFLEA 188
               :..::|....|        ||::.:..:..:..|    |.|:.::|..|
Mosquito   133 ---LQMMVGANISQ--------DQLNSIAERTIVEADTVGVGKISFDDFCRA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 42/182 (23%)
AgaP_AGAP001760XP_321323.3 PTZ00183 19..177 CDD:185503 42/182 (23%)
EFh 108..174 CDD:238008 23/77 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.