DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and DUOX

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_319115.4 Gene:DUOX / 1279399 VectorBaseID:AGAP009978 Length:1475 Species:Anopheles gambiae


Alignment Length:128 Identity:32/128 - (25%)
Similarity:61/128 - (47%) Gaps:3/128 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFK 122
            |:.....|..:|.........::...:|...|.:.:|.|||::.|.|:....||...::||..|.
Mosquito   775 VMRTSLSKSEFAAALGMKQDDMFVRKMFNIVDKDKDGRISFQEFLETVVLFSRGKTDDKLRIIFD 839

  Fly   123 LYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEF 185
            :.|.:.:|.|.:|||||::.::.|:...   ....|.:..:.:|.:|:.:.|.....:|.|:|
Mosquito   840 MCDNDRNGVIDKGELSEMMRSLVEIART---TSVTDEQVNELIDGMFQDVGLEHKNHLTYEDF 899

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 32/128 (25%)
DUOXXP_319115.4 An_peroxidase 7..518 CDD:281139
dual_peroxidase_like 9..562 CDD:188652
EFh 766..823 CDD:298682 11/47 (23%)
EFh 798..859 CDD:238008 21/60 (35%)
EF-hand_7 798..858 CDD:290234 21/59 (36%)
EFh 833..904 CDD:238008 19/70 (27%)
EF-hand_7 837..903 CDD:290234 17/66 (26%)
Ferric_reduct 1022..1155 CDD:280043
NOX_Duox_like_FAD_NADP 1203..1380 CDD:99783
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.