DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and AgaP_AGAP009626

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_318659.4 Gene:AgaP_AGAP009626 / 1279002 VectorBaseID:AGAP009626 Length:206 Species:Anopheles gambiae


Alignment Length:204 Identity:97/204 - (47%)
Similarity:145/204 - (71%) Gaps:6/204 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASPPESPIEEVVYELEHTRVP-KPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCF 64
            ::.||     :|..|.|...|| :..|.:|.:|.|..:||::||:.:|||||.|||.|:|.|:.|
Mosquito     5 LSLPP-----QVEPEAEDLPVPARYYPDSLVELTRTARFTEEEIKRIYRGFKAECPTGIVKEETF 64

  Fly    65 KDIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGD 129
            |.||::|||..:|..||||||.:.|::.||::||.:.:..||.||||:|.|:|:|||.|||:|||
Mosquito    65 KGIYSQFFPLASSGQYAHYVFNSIDLDRNGSLSFEEFVANLSILLRGTVDEKLQWTFSLYDINGD 129

  Fly   130 GRISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDL 194
            |.|::.|:.||:.||:||||:.|...|:::..:|:|:|:|.|:|.|.||.||::||:|.|.||:.
Mosquito   130 GCITKEEMKEIVTAIYELMGKVPEGCEEEQAIKDKVERLFEKMDRNCDGKITLDEFIECCTKDES 194

  Fly   195 VTRSLQMFD 203
            :.||:.:||
Mosquito   195 IRRSIAVFD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 83/162 (51%)
AgaP_AGAP009626XP_318659.4 FRQ1 28..195 CDD:227455 85/166 (51%)
EFh 80..142 CDD:238008 34/61 (56%)
EFh 116..187 CDD:238008 36/70 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28990
OrthoDB 1 1.010 - - D143871at50557
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.