DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and AgaP_AGAP008072

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_317385.4 Gene:AgaP_AGAP008072 / 1277877 VectorBaseID:AGAP008072 Length:1053 Species:Anopheles gambiae


Alignment Length:165 Identity:45/165 - (27%)
Similarity:74/165 - (44%) Gaps:23/165 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QTKFTKQEIRVMYRGF-KTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISF 98
            :|.|.|..:..:.:.| ||...|..:..:.||.|.....|     .:...||:.||.:.:|:||.
Mosquito    68 RTGFDKSSLERLEQLFIKTVGNEKEIRREEFKKIVTSKNP-----FFTERVFQIFDKDNSGSISL 127

  Fly    99 RDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDDRKARD 163
            ::.:..:......|..:::::.||:|||:|||.|...||..::.|..|..|.        |.:.|
Mosquito   128 QEFIDAIHQFAGQSPEDKIKFLFKVYDLDGDGLIQHRELQHVMRACMEENGM--------RFSED 184

  Fly   164 QVD----RVFRKLDLNQDGIITIEEFLEACLKDDL 194
            |::    .:|...|....|.||.|     .||:.|
Mosquito   185 QIEDLTMAMFEDADKYNRGAITYE-----ALKNQL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 43/161 (27%)
AgaP_AGAP008072XP_317385.4 FRQ1 60..212 CDD:227455 43/161 (27%)
EFh 111..171 CDD:238008 19/59 (32%)
EFh 145..208 CDD:238008 22/70 (31%)
Ferric_reduct 302..442 CDD:280043
NOX_Duox_like_FAD_NADP 486..>553 CDD:99783
FNR_like <844..>898 CDD:297884
NAD_binding_6 872..1038 CDD:285298
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.