DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and AgaP_AGAP007248

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_001687986.1 Gene:AgaP_AGAP007248 / 1269900 VectorBaseID:AGAP007248 Length:186 Species:Anopheles gambiae


Alignment Length:172 Identity:59/172 - (34%)
Similarity:109/172 - (63%) Gaps:3/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCN 93
            ::.|...|::.:..|:..|:|||.:||.|.:....|.|:|..|||.||:..:..:||:.||::.|
Mosquito    15 MDFLKSHTRYDESTIKEWYKGFKQDCPNGKLTPAKFVDMYKMFFPSGNAEEFCDHVFRTFDMDKN 79

  Fly    94 GAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGR-RPHQPED 157
            |.|.|::.|:.:.....|:..|:|:|.|::||::|:|.|...|:::|:.||::::|. ..::|.|
Mosquito    80 GYIDFKEFLLAIDVTSSGTPEEKLKWAFRMYDVDGNGVIDIQEMTKIVQAIYDMLGACSSNKPAD 144

  Fly   158 DRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSL 199
              .|.::...:|.|:|.|.||.:|.:|||:.||:|:.:::.|
Mosquito   145 --SAEERAKNIFAKMDENNDGQLTQDEFLKGCLQDEELSKML 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 57/163 (35%)
AgaP_AGAP007248XP_001687986.1 FRQ1 18..178 CDD:227455 57/161 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X31
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.