DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and LOC118142757

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_000400.2 Gene:LOC118142757 / 118142757 -ID:- Length:201 Species:Homo sapiens


Alignment Length:188 Identity:70/188 - (37%)
Similarity:99/188 - (52%) Gaps:24/188 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 KFTKQEIRVMYRGFKTECPEG--VVHEDCFKDIYAKFFPHGN----SSLYAHYVFKAFDVNCNGA 95
            :.:..|....|:.|.||||.|  .::|      :.:||...|    :|.|...:|:.||.|.:|.
Human    12 ELSSTECHQWYKKFMTECPSGQLTLYE------FRQFFGLKNLSPSASQYVEQMFETFDFNKDGY 70

  Fly    96 ISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDD-- 158
            |.|.:.:..||.:|:|.|.::|||.|||||::|:|.|.|.||..||.||      |...|..|  
Human    71 IDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAI------RAINPCSDTT 129

  Fly   159 RKARDQVDRVFRKLDLNQDGIITIEEFLEACLKD----DLVTRSLQMFDNDLXXQEGE 212
            ..|.:..|.||.|:|:|.||.:::|||:|...||    |.:||||.:.......|.||
Human   130 MTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGE 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 60/162 (37%)
LOC118142757NP_000400.2 FRQ1 12..163 CDD:227455 60/162 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143238
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.