DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and LOC101886535

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_005156540.1 Gene:LOC101886535 / 101886535 -ID:- Length:236 Species:Danio rerio


Alignment Length:200 Identity:91/200 - (45%)
Similarity:142/200 - (71%) Gaps:6/200 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ESPIEEV-VYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYA 69
            |||.:|: ::.....|     |..||.|..:|||:|.|::.:|||||.|||.|.|:|..||.||:
Zfish    40 ESPEDELKIFSFVCHR-----PEQLEILQEETKFSKTELQFLYRGFKNECPSGYVNEKVFKLIYS 99

  Fly    70 KFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISR 134
            :|||.|:|.:|||::|:|||.|.||.:||::.:..||.:||||:|:||.|.|..|||:.||.|:|
Zfish   100 QFFPQGDSCVYAHFLFEAFDTNRNGCLSFQEFVAGLSLILRGSMYDRLNWAFNFYDLDKDGFITR 164

  Fly   135 GELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSL 199
            .|:..::.:|:::||:..|...::..||:.|:..|:|:|.::||:||||||:|:|.||:.:.||:
Zfish   165 KEMMNVMKSIYDMMGKYVHPEINEETAREHVENFFQKMDRDRDGVITIEEFMESCQKDENIMRSM 229

  Fly   200 QMFDN 204
            ::||:
Zfish   230 RLFDS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 79/162 (49%)
LOC101886535XP_005156540.1 FRQ1 66..225 CDD:227455 78/158 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9251
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3687
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm24851
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
99.070

Return to query results.
Submit another query.