DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and kcnip4a

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_021333732.1 Gene:kcnip4a / 100536963 ZFINID:ZDB-GENE-131003-3 Length:230 Species:Danio rerio


Alignment Length:199 Identity:94/199 - (47%)
Similarity:145/199 - (72%) Gaps:4/199 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ESPIEEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAK 70
            :..||:   |||.:.| :..|.|||.|..||:|:::|::::|||||.|||.|||:||.||:|||:
Zfish    34 DDSIED---ELELSAV-RHRPEALEQLEAQTRFSRKELQILYRGFKNECPSGVVNEDTFKEIYAQ 94

  Fly    71 FFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRG 135
            |||.|::|.|||::|.|||.:.||::||.|.::.||.||||||.|:|.|.|.|||:|.||.|::.
Zfish    95 FFPQGDASTYAHFLFNAFDTDHNGSVSFEDFVMGLSILLRGSVQEKLNWAFNLYDINKDGYITKE 159

  Fly   136 ELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQ 200
            |:.:||.:|:::||:..:....:...|..|:..|:|:|.|:||::||:||::.|..|:.:.||:|
Zfish   160 EMLDIIKSIYDMMGKCTYPILKEETPRQHVEIFFQKMDKNRDGVVTIDEFIDCCQNDENIMRSMQ 224

  Fly   201 MFDN 204
            :|:|
Zfish   225 LFEN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 80/162 (49%)
kcnip4aXP_021333732.1 FRQ1 53..219 CDD:227455 81/165 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576098
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3687
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1513542at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm24851
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5210
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.930

Return to query results.
Submit another query.