DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and kcnip4b

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_003197705.2 Gene:kcnip4b / 100534855 ZFINID:ZDB-GENE-090313-35 Length:225 Species:Danio rerio


Alignment Length:179 Identity:87/179 - (48%)
Similarity:132/179 - (73%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDV 90
            |..||.|..||.|::||::::|||||.:||.|||:||.||:|||.|||.|:||.||.::|.|||.
Zfish    45 PENLEQLQSQTHFSRQELQLLYRGFKNDCPSGVVNEDTFKNIYALFFPLGDSSKYAQFLFNAFDK 109

  Fly    91 NCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQP 155
            :.||::||.:|:..||.||||:..|:|.|.|.|||:|.||:|::.|:.:|:.:|::|||:..|..
Zfish   110 DKNGSLSFEELVCDLSVLLRGTTEEKLNWAFNLYDINKDGQITKEEMLDIMKSIYDLMGKSIHPR 174

  Fly   156 EDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            ..:...|..|...|:.:|:||||::||:||:::|.||:.:.:||::|||
Zfish   175 LKEEAVRQHVRMFFQNMDINQDGVVTIDEFIDSCEKDEHIMQSLKIFDN 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 79/162 (49%)
kcnip4bXP_003197705.2 FRQ1 48..214 CDD:227455 81/165 (49%)
EF-hand_8 74..121 CDD:290545 27/46 (59%)
EFh 99..161 CDD:238008 30/61 (49%)
EFh 135..206 CDD:238008 29/70 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576099
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 206 1.000 Inparanoid score I3687
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1513542at2759
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm24851
orthoMCL 1 0.900 - - OOG6_101448
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.