DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and cog5

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_031754876.1 Gene:cog5 / 100498348 XenbaseID:XB-GENE-950363 Length:830 Species:Xenopus tropicalis


Alignment Length:212 Identity:50/212 - (23%)
Similarity:76/212 - (35%) Gaps:61/212 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 QTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFR 99
            |...||:...|.:..|..|     :.:|...||..||:......|.:.:. ||  .||:      
 Frog   322 QKVLTKKRDPVSHVCFIDE-----IAKDGHSDILYKFWSSVTQILSSQFE-KA--TNCS------ 372

  Fly   100 DLLVTLSTLLRGSVYERLR-----W-TFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQP-ED 157
               :.|.....|...:.||     | ..:.|..|..|..|....|:::..:         || ||
 Frog   373 ---MFLKQAFEGEYPKLLRLYNDLWKRLQQYSQNLQGSFSNSGNSDLVSDL---------QPTED 425

  Fly   158 DRKARDQVDRVFRKLDLNQDGIITIEEFLEA--CLKDDL-------VTRSL-QMFD--NDLXXQE 210
            |.                ||..||.::.::|  .|||.|       :::|| ::||  |.:....
 Frog   426 DA----------------QDIFITKKQDVDAEKMLKDSLQPYEAAYLSKSLSRLFDPINLVFPPG 474

  Fly   211 GELEPGLRNSRTIISLI 227
            |...|......:||..|
 Frog   475 GRNPPSADELDSIIKTI 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 37/165 (22%)
cog5XP_031754876.1 COG5 37..159 CDD:192566
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165162817
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.