DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and kcnip1

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_002937770.1 Gene:kcnip1 / 100497014 XenbaseID:XB-GENE-973728 Length:230 Species:Xenopus tropicalis


Alignment Length:200 Identity:97/200 - (48%)
Similarity:146/200 - (73%) Gaps:1/200 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PESPIEEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYA 69
            |::..::|..|||.|.|... |..||.|..||.|.|:|::|:|||||.|||.|||:||.||.||:
 Frog    30 PQNKSDKVEDELEMTTVCYR-PEGLEQLEAQTNFNKRELQVLYRGFKNECPSGVVNEDTFKLIYS 93

  Fly    70 KFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISR 134
            :|||||::|:||||:|.|||...:|::.|.|.:..||.|||||::|:|||||.|||:|.||.|::
 Frog    94 QFFPHGDASMYAHYLFNAFDAAQSGSVKFEDFVAALSVLLRGSIHEKLRWTFNLYDINKDGNINK 158

  Fly   135 GELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSL 199
            .|:.:|:.||:::||:..:....:...:..|:..|:|:|.|:||::|::||:|:|.:||.:.|||
 Frog   159 EEMMDIVKAIYDMMGKYTYPVLKEDAPKQHVEVFFQKMDKNKDGVVTLDEFIESCQEDDNIMRSL 223

  Fly   200 QMFDN 204
            |:|:|
 Frog   224 QLFEN 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 81/162 (50%)
kcnip1XP_002937770.1 FRQ1 53..219 CDD:227455 83/165 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7187
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H22824
Inparanoid 1 1.050 211 1.000 Inparanoid score I3565
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm47690
Panther 1 1.100 - - O PTHR23055
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5210
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.