DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and kcnip2

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_031761874.1 Gene:kcnip2 / 100494608 XenbaseID:XB-GENE-988846 Length:252 Species:Xenopus tropicalis


Alignment Length:179 Identity:88/179 - (49%)
Similarity:136/179 - (75%) Gaps:0/179 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFKDIYAKFFPHGNSSLYAHYVFKAFDV 90
            |..||.|..||||||:|::|:|||||.|||.|:|:|:.||.||::|||.|:||:|||::|.|||.
 Frog    72 PEGLEQLQEQTKFTKKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGDSSMYAHFLFNAFDT 136

  Fly    91 NCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQP 155
            :.:|::||.|.:..||.:|||::.::|.|.|.|||||.||.|::.|:.:|:.:|:::||:..:..
 Frog   137 DHSGSVSFEDFVAGLSVILRGTIDDKLNWAFNLYDLNKDGCITKEEMLDIMKSIYDMMGKYTYPN 201

  Fly   156 EDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLVTRSLQMFDN 204
            ..:...|:.|:..|:|:|.|:||::|||||:|:|.||:.:.||:|:|||
 Frog   202 MREEAPREHVENFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 79/162 (49%)
kcnip2XP_031761874.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7187
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 211 1.000 Inparanoid score I3565
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm47690
Panther 1 1.100 - - O PTHR23055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X31
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.160

Return to query results.
Submit another query.