DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and lrit3

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_002934296.2 Gene:lrit3 / 100494489 XenbaseID:XB-GENE-6076513 Length:652 Species:Xenopus tropicalis


Alignment Length:145 Identity:29/145 - (20%)
Similarity:52/145 - (35%) Gaps:37/145 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ISFRDLLVTLSTL--LRGSVYERLRWTFKLYDLNGDGRISRGELSEIILAIHELMGRRPHQPEDD 158
            :..:.|.||.:::  :..|.:..|:   :|::|..||       :.|.:...|.:...|.     
 Frog    81 VDLKYLWVTYNSISSIDSSSFYNLK---QLHELRLDG-------NAISVFPWESLAEMPS----- 130

  Fly   159 RKARDQVDRVFRKLDLNQDGIITI----EEFLEACLKDDLVTRSLQMFDNDL------XXQEGEL 213
                      .|.|||:.:.|.:|    ..:|......||.:..|....:||      ...:..:
 Frog   131 ----------LRTLDLHNNKIASIPAESARYLRNITYLDLSSNKLTTLPSDLLDIWPPFSDKSLI 185

  Fly   214 EPGLRNSRTIISLID 228
            ...|...|.|:.|.|
 Frog   186 SSDLLTQRVILGLQD 200

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 19/101 (19%)