DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5890 and kcnip3

DIOPT Version :9

Sequence 1:NP_001356889.1 Gene:CG5890 / 43126 FlyBaseID:FBgn0039380 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_002932578.2 Gene:kcnip3 / 100494097 -ID:- Length:284 Species:Xenopus tropicalis


Alignment Length:204 Identity:93/204 - (45%)
Similarity:144/204 - (70%) Gaps:7/204 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SP--PESPIEEVVYELEHTRVPKPIPVALEDLCRQTKFTKQEIRVMYRGFKTECPEGVVHEDCFK 65
            ||  |:|...::  ||...|..   |..|:.|...|||||:|::.:|||||.|||.|:|.|:.||
 Frog    84 SPQGPDSSDSDI--ELSTVRHQ---PEGLDQLQAVTKFTKKELQSLYRGFKNECPSGLVDEETFK 143

  Fly    66 DIYAKFFPHGNSSLYAHYVFKAFDVNCNGAISFRDLLVTLSTLLRGSVYERLRWTFKLYDLNGDG 130
            .||::|||.|::::|||::|.|||::.:|||.|.|.::.||.||||:::|:|:|.|.|||:|.||
 Frog   144 LIYSQFFPQGDATMYAHFLFNAFDMDRSGAIRFEDFVIGLSILLRGTIHEKLKWAFNLYDINKDG 208

  Fly   131 RISRGELSEIILAIHELMGRRPHQPEDDRKARDQVDRVFRKLDLNQDGIITIEEFLEACLKDDLV 195
            .|::.|:..|:.:|:::|||..:....|....:.|:|.|:|:|.|:||::||:||||.|.||:.:
 Frog   209 YITKEEMLAIMKSIYDMMGRYTYPLLRDDAPIEHVERFFQKMDRNRDGVVTIDEFLETCQKDENI 273

  Fly   196 TRSLQMFDN 204
            .||:|:|:|
 Frog   274 MRSMQLFEN 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5890NP_001356889.1 FRQ1 29..192 CDD:227455 78/162 (48%)
kcnip3XP_002932578.2 FRQ1 114..273 CDD:227455 78/158 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 96 1.000 Domainoid score I7187
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 211 1.000 Inparanoid score I3565
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606780at33208
OrthoFinder 1 1.000 - - FOG0000038
OrthoInspector 1 1.000 - - otm47690
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5210
SonicParanoid 1 1.000 - - X31
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.